Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD242 Recombinant Protein

Product Specifications

Background

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.

CAS Number

9000-83-3

Swiss Prot

Q14773

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~28kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dengue virus (DENV) (type 3, strain Philippines/H87/1956) E/Envelope HEK293 Cell Lysate (WB positive control)
MBS8116134-01 0.3 mg

Dengue virus (DENV) (type 3, strain Philippines/H87/1956) E/Envelope HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Dengue virus (DENV) (type 3, strain Philippines/H87/1956) E/Envelope HEK293 Cell Lysate (WB positive control)
MBS8116134-02 5x 0.3 mg

Dengue virus (DENV) (type 3, strain Philippines/H87/1956) E/Envelope HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
2-Cyclohexylamino-thiazol-4-one
sc-274803 1 g

2-Cyclohexylamino-thiazol-4-one

Sign In for Pricing
View Details
4933412E24Rik 3'UTR Luciferase Stable Cell Line
TU100848 1.0 mL

4933412E24Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Monoclonal C1qR1/CD93 Antibody (Dcby02) [Janelia Fluor 635]
NBP3-28221JF635 0.1 mL

Human Monoclonal C1qR1/CD93 Antibody (Dcby02) [Janelia Fluor 635]

Sign In for Pricing
View Details
INS Antibody, HRP conjugated
A44834-50UG 50 µg

INS Antibody, HRP conjugated

Sign In for Pricing
View Details