Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD242 Recombinant Protein

Product Specifications

Background

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.

CAS Number

9000-83-3

Swiss Prot

Q14773

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~28kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-8 non-lytic Recombinant Protein Fc Tag Lyophilized
MBS8432529-01 0.05 mg

Human IL-8 non-lytic Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Human IL-8 non-lytic Recombinant Protein Fc Tag Lyophilized
MBS8432529-02 5x 0.05 mg

Human IL-8 non-lytic Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Mouse Anti-Feline MHC Class II Monomorphic Monoclonal Antibody
VD12N101 1 Each

Mouse Anti-Feline MHC Class II Monomorphic Monoclonal Antibody

Sign In for Pricing
View Details
Mobkl2a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4989603 1.0 µg DNA

Mobkl2a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Tough-Tags 1.28 x 0.50" Green
TTLG-1000 1 Roll

Tough-Tags 1.28 x 0.50" Green

Sign In for Pricing
View Details
EIF4A2 Antibody, Biotin conjugated
A15178-50UG 50 µg

EIF4A2 Antibody, Biotin conjugated

Sign In for Pricing
View Details