Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD242 Recombinant Protein

Product Specifications

Background

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.

CAS Number

9000-83-3

Swiss Prot

Q14773

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~28kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)
367016-01 25 Tests

CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)
367016-02 100 Tests

CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)
367016-03 200 Tests

CD117 (c-kit, Stem Cell Factor Receptor, SCFR, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (PE)

Sign In for Pricing
View Details
NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)
MBS6326287-01 0.1 mL

NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)

Sign In for Pricing
View Details
NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)
MBS6326287-02 5x 0.1 mL

NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)

Sign In for Pricing
View Details
CD82 Antibody
GWB-MW845H 50 µg

CD82 Antibody

Sign In for Pricing
View Details