Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Recombinant Protein

Product Specifications

Background

CD2 is a transmembrane glycoprotein expressed early in thymocyte development and present on most circulating T cells. CD2 plays a role in T cell adhesion through binding to its ligand CD58 (LFA-3) . Stimulation of CD2 also leads to T cell activation and proliferation. T cells from mice deficient in both CD2 and CD28 have severe defects in T cell activation and function, while T cells deficient in either CD2 or CD28 are still capable of mounting a response, suggesting that CD2 and CD28 may have overlapping functions and may be able to compensate for each other. In addition, engagement of CD2 and CD58 was recently demonstrated to be the primary costimulatory signal in T cells that lack CD28. CD2 expression also distinguishes a subset of plasmacytoid dendritic cells found in tumors and tonsils that express lysozyme, higher levels of IL-12 p40, and higher levels of CD80.

CAS Number

9000-83-3

Swiss Prot

P06729

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~26kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY KLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTL TCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCP EKGLD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arginine Vasopressin Receptor 1A (AVPR1A) Chicken ELISA Kit
B7581 96 Tests

Arginine Vasopressin Receptor 1A (AVPR1A) Chicken ELISA Kit

Sign In for Pricing
View Details
TFAP2A for Dual Luciferase Vectors (LR-2XXXD)
LR-2094D 1 Each

TFAP2A for Dual Luciferase Vectors (LR-2XXXD)

Sign In for Pricing
View Details
YM Agar
HY-157379 1 Each

YM Agar

Sign In for Pricing
View Details
Mdfi sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4986604 1.0 µg DNA

Mdfi sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mdm1 Nuclear Protein (MDM1) Antibody
abx026744-01 80 µL

Mdm1 Nuclear Protein (MDM1) Antibody

Sign In for Pricing
View Details
Mdm1 Nuclear Protein (MDM1) Antibody
abx026744-02 400 µL

Mdm1 Nuclear Protein (MDM1) Antibody

Sign In for Pricing
View Details