Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD210 Recombinant Protein

Product Specifications

Background

The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to phosphorylation of JAK1 and Tyk 2 tyrosine kinases. The activated kinases phosphorylate the two tyrosine residues (Tyr 446 and Tyr 496) in the cytoplasmic domain of IL-10Rα. The phosphorylation of these two residues are required for proper function of IL-10R and activation of IL-10E1 signaling. IL-10Rβ is ubiquitously expressed and, in addition to forming the IL-10 heterodimeric receptor, it forms a heterodimeric receptor with an IL-22R subunit and an IL-28R subunit. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.

CAS Number

9000-83-3

Swiss Prot

Q13651

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~26kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSY DLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG KIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEF CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit
MBS9310643-01 48 Well

Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit

Sign In for Pricing
View Details
Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit
MBS9310643-02 96 Well

Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit

Sign In for Pricing
View Details
Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit
MBS9310643-03 5x 96 Well

Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit

Sign In for Pricing
View Details
Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit
MBS9310643-04 10x 96 Well

Rat phosphor-nuclear factor kappa B, p-NF-kappa B ELISA Kit

Sign In for Pricing
View Details
RAB39 AAV siRNA Pooled Vector
38330161 1.0 µg

RAB39 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
MBS2142773-01 0.1 mL

FITC-Linked Monoclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)

Sign In for Pricing
View Details