Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD210 Recombinant Protein

Product Specifications

Background

The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to phosphorylation of JAK1 and Tyk 2 tyrosine kinases. The activated kinases phosphorylate the two tyrosine residues (Tyr 446 and Tyr 496) in the cytoplasmic domain of IL-10Rα. The phosphorylation of these two residues are required for proper function of IL-10R and activation of IL-10E1 signaling. IL-10Rβ is ubiquitously expressed and, in addition to forming the IL-10 heterodimeric receptor, it forms a heterodimeric receptor with an IL-22R subunit and an IL-28R subunit. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.

CAS Number

9000-83-3

Swiss Prot

Q13651

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~26kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSY DLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG KIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEF CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1P43 sgRNA CRISPR Lentivector (Human) (Target 2)
K0621703 1.0 µg DNA

DNM1P43 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
IL17B Mouse Monoclonal Antibody [Clone ID: LBI8F7]
AMM20057VCF 100 µg

IL17B Mouse Monoclonal Antibody [Clone ID: LBI8F7]

Sign In for Pricing
View Details
Normal Guinea Pig Serum
88R-1016 5 ml

Normal Guinea Pig Serum

Sign In for Pricing
View Details
1810043G02Rik 3'UTR Luciferase Stable Cell Line
TU100334 1.0 mL

1810043G02Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Monoclonal uPAR Antibody (014) [Alexa Fluor 647]
NBP2-90454AF647 0.1 mL

Rabbit Monoclonal uPAR Antibody (014) [Alexa Fluor 647]

Sign In for Pricing
View Details
Olfr1163 Mouse shRNA Lentiviral Particle (Locus ID 258638)
TL507822V 500 µL Each

Olfr1163 Mouse shRNA Lentiviral Particle (Locus ID 258638)

Sign In for Pricing
View Details