Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD58 Recombinant Protein

Product Specifications

Background

CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.

CAS Number

9000-83-3

Swiss Prot

P19256

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase (TS106 + TMS715), CF647 conjugate, 0.1mg/mL
BNC470716-100 1x 100 µL

Thymidylate Synthase (TS106 + TMS715), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SB 203580 Hydrochloride
TRC-S155058-25MG 25 mg

SB 203580 Hydrochloride

Sign In for Pricing
View Details
TIA1 Human Gene Knockout Kit (CRISPR)
KN415053 1 Kit

TIA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rint1 Mouse Gene Knockout Kit (CRISPR)
KN514836 1 Kit

Rint1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR1C1 Human Gene Knockout Kit (CRISPR)
KN416791 1 Kit

OR1C1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KIF4A Human Knockdown Lysate
LY300221 100 µg

KIF4A Human Knockdown Lysate

Sign In for Pricing
View Details