Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38 Recombinant Protein

Product Specifications

Background

Cyclic ADP-ribose hydrolase 1 (CD38) is a transmembrane protein involved in several important biological processes, including immune response, insulin secretion, and social behavior. Originally described as a glycosylated immune cell surface marker, additional research determined that CD38 is a multifunctional enzyme that catalyzes the synthesis and hydrolysis of cyclic ADP ribose (cADPR) from NAD. Under acidic conditions, CD38 also catalyzes the synthesis of nicotinic acid adenine dinucleotide phosphate (NAADP) from NADP+. Both cADPR and NAADP act as calcium ion mobilizing messengers that target different intracellular Ca2+ stores. Since CD38 is the primary mammalian NAD+ glycohydrolase responsible for NAD+ metabolism, CD38 may be a valuable therapeutic target for treatment of metabolic diseases regulated by NAD+-dependent pathways. CD38 has also been considered a possible therapeutic target for antibody-mediated therapy for myeloma and chronic lymphocytic leukemia.

CAS Number

9000-83-3

Swiss Prot

P28907

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~36kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNIT EEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGE FNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTF GSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPD KFLQCVKNPEDSSCTSEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdh10 (NM_001098170) Mouse Tagged ORF Clone
MG215284 10 µg

Pcdh10 (NM_001098170) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Heparanase Antibody
E51A09633 100 µL

Heparanase Antibody

Sign In for Pricing
View Details
Dnmt3b sgRNA CRISPR Lentivector set (Mouse)
K4453401 3x 1.0 µg

Dnmt3b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
VAMP4 Polyclonal Antibody
ANT-14990-50ug 50 µg

VAMP4 Polyclonal Antibody

Sign In for Pricing
View Details
VGLL2 (Biotin)
581160-01 50 µg

VGLL2 (Biotin)

Sign In for Pricing
View Details
VGLL2 (Biotin)
581160-02 100 µg

VGLL2 (Biotin)

Sign In for Pricing
View Details