Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD369 Recombinant Protein

Product Specifications

Background

Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of γδ T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for β-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes β-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.

CAS Number

9000-83-3

Swiss Prot

Q9BXN2

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~21kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWI IYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSR PQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKF SM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avermectin [HRP]
DAGA-038H 1mg

Avermectin [HRP]

Sign In for Pricing
View Details
10?-Hydroxycadina-4,11 (13) -dien-12,8?-olide
MF-0049704 5 mg

10?-Hydroxycadina-4,11 (13) -dien-12,8?-olide

Sign In for Pricing
View Details
Rabbit Anti-CREG1 antibody
SL9234R-01 50 µL

Rabbit Anti-CREG1 antibody

Sign In for Pricing
View Details
Rabbit Anti-CREG1 antibody
SL9234R-02 100 µL

Rabbit Anti-CREG1 antibody

Sign In for Pricing
View Details
OAF, NT (OAF, NS5ATP13TP2, Out at first protein homolog, HCV NS5A-transactivated protein 13 target protein 2) (FITC) discontinued
039242-FITC 200 µL

OAF, NT (OAF, NS5ATP13TP2, Out at first protein homolog, HCV NS5A-transactivated protein 13 target protein 2) (FITC) discontinued

Sign In for Pricing
View Details
Anti-SERPINC1 Polyclonal Antibody
PHB89401 100 μg

Anti-SERPINC1 Polyclonal Antibody

Sign In for Pricing
View Details