Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD369 Recombinant Protein

Product Specifications

Background

Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of γδ T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for β-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes β-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.

CAS Number

9000-83-3

Swiss Prot

Q9BXN2

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~21kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWI IYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSR PQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKF SM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSSCA1 (G-12) : m-IgGκ BP-HRP Bundle
sc-525035 1 Kit

SSSCA1 (G-12) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Thymus peptide C 5mg
A23426-5 5 mg

Thymus peptide C 5mg

Sign In for Pricing
View Details
SGK3 antibody
70R-5846 50 ug

SGK3 antibody

Sign In for Pricing
View Details
MEGF6 Protein Vector (Human) (pPM-C-HA)
PV093772 500 ng

MEGF6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (FITC)
249974-FITC 100 µL

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (FITC)

Sign In for Pricing
View Details
Arl5c ORF Vector (Mouse) (pORF)
ORF039046 1.0 µg DNA

Arl5c ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details