Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD369 Recombinant Protein

Product Specifications

Background

Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of γδ T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for β-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes β-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.

CAS Number

9000-83-3

Swiss Prot

Q9BXN2

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~21kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWI IYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSR PQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKF SM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-SHC1-(Y427) antibody
STJ22394 100 µl

Anti-Phospho-SHC1-(Y427) antibody

Sign In for Pricing
View Details
Mettl21c sgRNA CRISPR Lentivector set (Rat)
K6683301 3x 1.0 µg

Mettl21c sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride
OR1070759-01 50 mg

(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride
OR1070759-02 100 mg

(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride
OR1070759-03 250 mg

(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride
OR1070759-04 1 g

(R) -1- (2-Chloro-4-methylphenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details