Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD314 Recombinant Protein

Product Specifications

Background

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

CAS Number

9000-83-3

Swiss Prot

P26718

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~16kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNA SLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALY ASSFKGYIENCSTPNTYICMQRTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fine wall tip 250 uL bulk
DD77574 1000 / PCK

Fine wall tip 250 uL bulk

Sign In for Pricing
View Details
Multiplex Assay Kit for Low Density Lipoprotein Receptor (LDLR), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027466 96 Tests

Multiplex Assay Kit for Low Density Lipoprotein Receptor (LDLR), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Ald-Ph-amido-PEG3-NHS ester
T39535-01 100 mg

Ald-Ph-amido-PEG3-NHS ester

Sign In for Pricing
View Details
Ald-Ph-amido-PEG3-NHS ester
T39535-02 500 mg

Ald-Ph-amido-PEG3-NHS ester

Sign In for Pricing
View Details
VDAC/Porin Antibody
ASA-B1959 1 Each

VDAC/Porin Antibody

Sign In for Pricing
View Details
Lehmbachol D
orb1681041 5 mg

Lehmbachol D

Sign In for Pricing
View Details