Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD305 Recombinant Protein

Product Specifications

Background

LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.

CAS Number

9000-83-3

Swiss Prot

Q6GTX8

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~22kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Blocking Peptide
abx062101-01 1 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details
EGFR Blocking Peptide
abx062101-02 5 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details
FDXACB1 CRISPR Activation Plasmid (m2)
sc-436381-ACT-2 20 µg

FDXACB1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
ACAA2 Recombinant Protein (Rat)
RP188741 100 µg

ACAA2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
GH2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-13354R-BF405 100 µL

GH2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
KCNIP2 Antibody - middle region : HRP (ARP35490_P050-HRP)
ARP35490_P050-HRP 100 µL

KCNIP2 Antibody - middle region : HRP (ARP35490_P050-HRP)

Sign In for Pricing
View Details