Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD305 Recombinant Protein

Product Specifications

Background

LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.

CAS Number

9000-83-3

Swiss Prot

Q6GTX8

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~22kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri hemA Protein (aa 1-418)
VAng-Lsx07835-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri hemA Protein (aa 1-418)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) NAGB Polyclonal Antibody
MBS7184134 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) NAGB Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal SH3GLB1 Antibody - C-terminal region
APR09920G 0.05mg

Polyclonal SH3GLB1 Antibody - C-terminal region

Sign In for Pricing
View Details
Natriuretic Peptide Receptor A (NPR1) (NM_000906) Human Tagged ORF Clone
RG209267 10 µg

Natriuretic Peptide Receptor A (NPR1) (NM_000906) Human Tagged ORF Clone

Sign In for Pricing
View Details
ART5 Rabbit pAb
A7146-01 20 µL

ART5 Rabbit pAb

Sign In for Pricing
View Details
ART5 Rabbit pAb
A7146-02 100 μL

ART5 Rabbit pAb

Sign In for Pricing
View Details