Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD305 Recombinant Protein

Product Specifications

Background

LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.

CAS Number

9000-83-3

Swiss Prot

Q6GTX8

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~22kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMC1 Rabbit Polyclonal Antibody
E10G09396 100 µL

RMC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MED18 Antibody - C-terminal region
ARP62134_P050-25UL 25 µL

MED18 Antibody - C-terminal region

Sign In for Pricing
View Details
Human Rotavirus antigen (RV Ag) ELISA Kit
GA-E1766HM-01 48 Tests

Human Rotavirus antigen (RV Ag) ELISA Kit

Sign In for Pricing
View Details
Human Rotavirus antigen (RV Ag) ELISA Kit
GA-E1766HM-02 96 Tests

Human Rotavirus antigen (RV Ag) ELISA Kit

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA Rabbit pAb
APA2056-01 30 µL

Carcino Embryonic Antigen CEA Rabbit pAb

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA Rabbit pAb
APA2056-02 50 μL

Carcino Embryonic Antigen CEA Rabbit pAb

Sign In for Pricing
View Details