Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein S129A Mutant Monomers

Human Recombinant Alpha Synuclein S129A Mutant Monomers

Product Specifications

Background

Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson’s disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]) . Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2) . Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.

Product Name Alternative

Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Swiss Prot

P37840-1

Expression System

E. coli

Host

E. coli

Origin Species

Human

Target

Alpha Synuclein S129A

Conjugation

No Tag

Nature

Recombinant

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA

Applications

WB | In vivo Assay | In vitro Assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy

Purification Method

Ion-exchange Purified

Purification

Ion-exchange Purified

Limit Of Detection

Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

Concentration

2 mg/ml

Purity

>95%

Weight

0.01

Length

Full length (1 - 140 aa)

Buffer

1X PBS pH7.4

Molecular Weight

14.44 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For corresponding PFFs, see catalog# SPR-506

References & Citations

1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.13234 2. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For corresponding PFFs, see catalog# SPR-506

Protein Length

Full length (1 - 140 aa)

Background Reference 01

1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.13234 2. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA

Immunogen Species

Human

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPS1/RPS27 Rabbit Polyclonal Antibody (FITC)
orb2616987 100 µg

MPS1/RPS27 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ICAM-5, Human (539a.a, HEK293, Fc)
HY-P74870 1 Each

ICAM-5, Human (539a.a, HEK293, Fc)

Sign In for Pricing
View Details
Human Replication protein A 14 kDa subunit, RPA3 ELISA KIT
ELI-18079h 96 Tests

Human Replication protein A 14 kDa subunit, RPA3 ELISA KIT

Sign In for Pricing
View Details
GLIS3 Antibody
ABD7749 100 µg

GLIS3 Antibody

Sign In for Pricing
View Details
Recombinant Human IFT81 Protein, N-His
HP940012-01 50 µg

Recombinant Human IFT81 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IFT81 Protein, N-His
HP940012-02 100 µg

Recombinant Human IFT81 Protein, N-His

Sign In for Pricing
View Details