Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant PFFs

Product Specifications

Background

Human alpha synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse α-syn pathology (1) . A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro (2,3) . Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after single unilateral injection into the dorsal striatum in mice (4) . Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.

Product Name Alternative

Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Swiss Prot

P37840-1

Expression System

E. coli

Host

E. coli

Origin Species

Human

Target

Alpha Synuclein TNG (A53T, S87N, N103G)

Conjugation

No Tag

Nature

Recombinant

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Applications

WB | In vivo Assay | In vitro Assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy

Purification Method

Ion-exchange Purified

Purification

Ion-exchange Purified

Limit Of Detection

Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

Concentration

2 mg/ml or 5 mg/ml

Purity

>95%

Weight

0.05

Length

Full length (1 - 140 aa)

Buffer

1X PBS pH7.4

Molecular Weight

14.46 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-503.

References & Citations

1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/braiwt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.054

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-503.

Protein Length

Full length (1 - 140 aa)

Background Reference 01

1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/brain/awt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.053

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Immunogen Species

Human

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-466a-3p AAV miRNA Vector
Amm3074900 500 ng

Inhibitor mmu-miR-466a-3p AAV miRNA Vector

Sign In for Pricing
View Details
Prss34 ORF Vector (Mouse) (pORF)
37846014 1.0 µg DNA

Prss34 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
6-Ethoxybenzo[d]oxazol-2-amine
OR1041010-01 100 mg

6-Ethoxybenzo[d]oxazol-2-amine

Sign In for Pricing
View Details
6-Ethoxybenzo[d]oxazol-2-amine
OR1041010-02 250 mg

6-Ethoxybenzo[d]oxazol-2-amine

Sign In for Pricing
View Details
6-Ethoxybenzo[d]oxazol-2-amine
OR1041010-03 1 g

6-Ethoxybenzo[d]oxazol-2-amine

Sign In for Pricing
View Details
Cytomegalovirus, Human, p65 IE (Immediate Early) (CMV) (MaxLight 650)
C9100-15A-ML650 100 µL

Cytomegalovirus, Human, p65 IE (Immediate Early) (CMV) (MaxLight 650)

Sign In for Pricing
View Details