RecombinantVEGF-C, Human
Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D) .Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 µg/mL.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
16~19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
CAS Number
9000-83-3
AA Sequence
MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items