Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF165, Human (HEK293-expressed)

Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 <16 ng/ml, measured in a cell proliferation assay using HUVEC cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

20~26 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STC2 Polyclonal Antibody
E-AB-90152-01 60 µL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
STC2 Polyclonal Antibody
E-AB-90152-02 120 µL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
STC2 Polyclonal Antibody
E-AB-90152-03 200 µL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
Vmn2r121 Mouse Gene Knockout Kit (CRISPR)
KN519136 1 Kit

Vmn2r121 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Xylazine-HRP Conjugate
50622-AAT 1 mg

Xylazine-HRP Conjugate

Sign In for Pricing
View Details
Chk1 (CHEK1) (NM_001274) Human Over-expression Lysate
LY400510 100 µg

Chk1 (CHEK1) (NM_001274) Human Over-expression Lysate

Sign In for Pricing
View Details