Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTkrA, Human

Tyrosine kinase receptor A (Trk-A) is a member of the neurotrophic tyrosine kinase receptor family which includes three members: Trk-A, Trk-B and Trk-C. Trk-A is involved in the development and maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic neurons.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 μg/ml, measured in a neutralization assay in the presence of 10 ng/ml human β-NGF using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

65~85 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Tyrosine kinase receptor A remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Tyrosine kinase receptor A should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHF TPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGV PTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGR AEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTH VNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Conjugated Griffonia simplicifolia Lectin -GS-II-
I-2402-1 1 mg

Ferritin Conjugated Griffonia simplicifolia Lectin -GS-II-

Sign In for Pricing
View Details
Human anti-human IL-2RA mAb (ABD)
E4A09D32-ABD-100 100 µg

Human anti-human IL-2RA mAb (ABD)

Sign In for Pricing
View Details
SLAIN1 (NM_001242870) Human Tagged ORF Clone
RG232056 10 µg

SLAIN1 (NM_001242870) Human Tagged ORF Clone

Sign In for Pricing
View Details
SPIN4 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2487730 100 µL

SPIN4 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
RASL11B Protein Vector (Human) (pPM-C-His)
PV114901 500 ng

RASL11B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GnRH-Receptor / LH-RH Receptor Antibody
orb1713044 0.1 mL

GnRH-Receptor / LH-RH Receptor Antibody

Sign In for Pricing
View Details