Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSCF, Rat (HEK293-expressed)

Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

10~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML PPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPG Antibody
orb1324898 100 µL

LIPG Antibody

Sign In for Pricing
View Details
p38 MAPK Monoclonal Conjugated Antibody
MBS9439398-01 0.1 mL (Biotin)

p38 MAPK Monoclonal Conjugated Antibody

Sign In for Pricing
View Details
p38 MAPK Monoclonal Conjugated Antibody
MBS9439398-02 0.1 mL (AF350)

p38 MAPK Monoclonal Conjugated Antibody

Sign In for Pricing
View Details
p38 MAPK Monoclonal Conjugated Antibody
MBS9439398-03 0.1 mL (AF405)

p38 MAPK Monoclonal Conjugated Antibody

Sign In for Pricing
View Details
p38 MAPK Monoclonal Conjugated Antibody
MBS9439398-04 0.1 mL (AF488)

p38 MAPK Monoclonal Conjugated Antibody

Sign In for Pricing
View Details
p38 MAPK Monoclonal Conjugated Antibody
MBS9439398-05 0.1 mL (AF555)

p38 MAPK Monoclonal Conjugated Antibody

Sign In for Pricing
View Details