Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSCF, Rat (HEK293-expressed)

Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

10~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML PPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r17 (NM_001104628) Mouse Tagged ORF Clone
MG214113 10 µg

Vmn2r17 (NM_001104628) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human JUN / Transcription factor AP-1 Recombinant Protein
R1292h 1 Each

Human JUN / Transcription factor AP-1 Recombinant Protein

Sign In for Pricing
View Details
Automatic Fill for Rodwell autoclaves
AUT1349 1 Each

Automatic Fill for Rodwell autoclaves

Sign In for Pricing
View Details
EGF Polyclonal Antibody
A52110-100 100 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 2 Group E Member 1 (NR2E1, Nuclear Receptor TLX, Protein Tailless Homolog, Tailless Homolog, Tll, hTll, TLX, XTLL)
N6889-94E2 100 µg

Nuclear Receptor Subfamily 2 Group E Member 1 (NR2E1, Nuclear Receptor TLX, Protein Tailless Homolog, Tailless Homolog, Tll, hTll, TLX, XTLL)

Sign In for Pricing
View Details
Cxcr2 3'UTR Luciferase Stable Cell Line
TU202999 1.0 mL

Cxcr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details