Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantRANTES/CCL5, Human (HEK293-expressed)

Chemokine (C-C motif) ligand 5 (CCL5), also known as RANTES (Regulated upon activation, Normal T cell Expressed and presumable Secreted) is a CC-chemokine that can signal through the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. RANTES is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes in inflammatory sites. With the help of specific cytokines (i.e., IL-2 and IFN-γ) that are released by T cells, RANTES induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells. RANTES is also an HIV-suppressive factor released from CD8+ T cells. This chemokine has been localized to chromosome 17 in humans. It has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV) .Recombinant human RANTES/CCL5 produced in HEK293 cells is a single polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhRANTES/CCL5 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human RANTES/CCL5 on Caˆ2+ mobilization assay in CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells) is less than 0.2 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human RANTES/CCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human RANTES/CCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE YINSLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PuuC Antibody
orb825262 2 mg

PuuC Antibody

Sign In for Pricing
View Details
Human Monoclonal FCRL5/FcRH5/IRTA2 Antibody (cevostamab) [Janelia Fluor 585]
NBP3-28621JF585 0.1 mL

Human Monoclonal FCRL5/FcRH5/IRTA2 Antibody (cevostamab) [Janelia Fluor 585]

Sign In for Pricing
View Details
IVNS1ABP Rabbit Polyclonal Antibody (Fluoro647)
orb3095774 100 µg

IVNS1ABP Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Tixocortol pivalate
HY-130365-01 1 mg

Tixocortol pivalate

Sign In for Pricing
View Details
Tixocortol pivalate
HY-130365-02 5 mg

Tixocortol pivalate

Sign In for Pricing
View Details
Tixocortol pivalate
HY-130365-03 10 mg

Tixocortol pivalate

Sign In for Pricing
View Details