Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-CC, Human

Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB) .

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP2A Peptide - C-terminal region
orb1999366 100 µg

TOP2A Peptide - C-terminal region

Sign In for Pricing
View Details
Lentiviral human HAX1 shRNA (UAS) - Lentiviral human HAX1 shRNA (UAS, RFP) (25)
GTR15327182 1 Vial

Lentiviral human HAX1 shRNA (UAS) - Lentiviral human HAX1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat IRF4 (Interferon Regulatory Factor 4) ValidElisa Kit
EK342512 96 Well

Rat IRF4 (Interferon Regulatory Factor 4) ValidElisa Kit

Sign In for Pricing
View Details
Pxmp3 3'UTR GFP Stable Cell Line
TU267132 1.0 mL

Pxmp3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
EGFL7 Conjugated Antibody
MBS9446186-01 0.1 mL (Biotin)

EGFL7 Conjugated Antibody

Sign In for Pricing
View Details
EGFL7 Conjugated Antibody
MBS9446186-02 0.1 mL (AF350)

EGFL7 Conjugated Antibody

Sign In for Pricing
View Details