Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNGFR, Human

NGF Receptor, also known as Gp80-LNGFR, p75 ICD, CD271 and TNFRSF16, is a type I transmembrane protein belonging to the TNF receptor family. It is expressed by both neuronal and non-neuronal cells. Signaling through NGF Receptor has been shown to regulate gene expression, cell migration and death. A truncated NGF Receptor containing only the extracellular domain has been detected in plasma, amniotic fluid and urine, and acts as a potent NGF antagonist.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 μg /ml, measured in a neutrolization assay using TF-1 cells in the presence of 10ng/ml human b-NGF.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

32-60 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human NGF Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NGF Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCR CAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAEC EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gram's Decolorizer Solution
GDS125 125 mL

Gram's Decolorizer Solution

Sign In for Pricing
View Details
RPL29P2 Protein Vector (Human) (pPM-C-His)
PV121965 500 ng

RPL29P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-FAT4 Antibody
CQA9433-01 30 µL

Anti-FAT4 Antibody

Sign In for Pricing
View Details
Anti-FAT4 Antibody
CQA9433-02 50 μL

Anti-FAT4 Antibody

Sign In for Pricing
View Details
Anti-FAT4 Antibody
CQA9433-03 100 µL

Anti-FAT4 Antibody

Sign In for Pricing
View Details
Anti-FAT4 Antibody
CQA9433-04 200 µL

Anti-FAT4 Antibody

Sign In for Pricing
View Details