Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMIP-1α/CCL3, Mouse

MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process.Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

The EC50 value of mouse MIP-1α/CCL3 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

7.8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFGE8 (Lactadherin, Breast Epithelial Antigen BA46, HMFG, MFGM, Milk Fat Globule-EGF Factor 8, MFG-E8, SED1, Lactadherin Short Form, Medin) (MaxLight 650)
129607-ML650 100 µL

MFGE8 (Lactadherin, Breast Epithelial Antigen BA46, HMFG, MFGM, Milk Fat Globule-EGF Factor 8, MFG-E8, SED1, Lactadherin Short Form, Medin) (MaxLight 650)

Sign In for Pricing
View Details
N1, N1-Dimethylspiro[3.3]heptane-1,3-diamine dihydrochloride
PED67157-01 50 mg

N1, N1-Dimethylspiro[3.3]heptane-1,3-diamine dihydrochloride

Sign In for Pricing
View Details
N1, N1-Dimethylspiro[3.3]heptane-1,3-diamine dihydrochloride
PED67157-02 0.5 g

N1, N1-Dimethylspiro[3.3]heptane-1,3-diamine dihydrochloride

Sign In for Pricing
View Details
CBS Rabbit Polyclonal Antibody (AP)
orb892809 100 µL

CBS Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Necdin Rabbit Polyclonal Antibody (BF750)
orb2401050 100 µL

Necdin Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
LOXL2 Rabbit Polyclonal Antibody (FITC)
orb102925 100 µg

LOXL2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details