Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMCP-1/CCL2, Rat

Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

10~15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat MCP-1/CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1/CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conjugated NDUFS2 Rabbit mAb
C57126 100 µL

Conjugated NDUFS2 Rabbit mAb

Sign In for Pricing
View Details
LBP Rabbit Polyclonal Antibody (FITC)
orb189177 100 µL

LBP Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Acyl Carrier Protein (ACP) Polyclonal Antibody
VD3N574 1 Each

Rabbit Anti-Mouse Acyl Carrier Protein (ACP) Polyclonal Antibody

Sign In for Pricing
View Details
Olfr123 AAV siRNA Pooled Vector
32689164 1.0 µg

Olfr123 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GLYATL2 3'UTR Luciferase Stable Cell Line
TU008937 1.0 mL

GLYATL2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CCAR2 Antibody
orb674308-01 50 µg

CCAR2 Antibody

Sign In for Pricing
View Details