Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMCP-1/CCL2, Mouse

Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several types of disease characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant mouse MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMCP-1/CCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCCR2 cells (human Ga15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse MCP-1/CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP-1/CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKACG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1720606 1.0 µg DNA

PRKACG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Gnal sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6890606 1.0 µg DNA

Gnal sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RBM11 Protein (N-GST & C-His, Human)
P507715 100 µg

RBM11 Protein (N-GST & C-His, Human)

Sign In for Pricing
View Details
GFP Monoclonal Antibody (Mix)
44046-01 50 µL

GFP Monoclonal Antibody (Mix)

Sign In for Pricing
View Details
GFP Monoclonal Antibody (Mix)
44046-02 100 µL

GFP Monoclonal Antibody (Mix)

Sign In for Pricing
View Details
HRSP12 (RIDA) Human Over-expression Lysate
orb1346730 100 µg

HRSP12 (RIDA) Human Over-expression Lysate

Sign In for Pricing
View Details