Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIP-10/CRG-2/CXCL10, Rat

C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of the skin. Recombinant rat IP-10/CRG-2/CXCL10 produced in HEK 293 cells is a polypeptide chain containing 77 amino acids. A fully biologically active molecule, rr IP-10/CRG-2/CXCL10 has a molecular mass of 8.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat IP-10/CRG-2/CXCL10 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells) is less than 300 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8.7 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat IP-10/CRG-2/CXCL10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat IP-10/CRG-2/CXCL10 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEA IKSLLKAVSQRRSKRAP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PAMR1 shRNA Plasmid (h)
sc-96863-SH 20 µg

PAMR1 shRNA Plasmid (h)

Ask
View Details
3,5-Diamino-4-chlorobenzonitrile
TRC-D416205-100MG 100 mg

3,5-Diamino-4-chlorobenzonitrile

Ask
View Details
PRMT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37717124 3x 1.0µg DNA

PRMT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details
PCDHGA9 Rabbit pAb
E47R11150 100 µL

PCDHGA9 Rabbit pAb

Ask
View Details
TMPRSS2, ID (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10) (MaxLight 490) discontinued
T8264-44A-ML490 100 µL

TMPRSS2, ID (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10) (MaxLight 490) discontinued

Ask
View Details