Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6, Rat (HEK293-expressed)

Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

21~26 kDa , observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Interleukin-6 (IL-6) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, it should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC7 siRNA (Human)
MBS8215563-01 15 nmol

DNAJC7 siRNA (Human)

Sign In for Pricing
View Details
DNAJC7 siRNA (Human)
MBS8215563-02 30 nmol

DNAJC7 siRNA (Human)

Sign In for Pricing
View Details
DNAJC7 siRNA (Human)
MBS8215563-03 5x 30 nmol

DNAJC7 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus srtA protein, N-His Tag
MBS1562939-01 0.05 mg

Recombinant Staphylococcus aureus srtA protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus srtA protein, N-His Tag
MBS1562939-02 0.1 mg

Recombinant Staphylococcus aureus srtA protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus srtA protein, N-His Tag
MBS1562939-03 5x 0.1 mg

Recombinant Staphylococcus aureus srtA protein, N-His Tag

Sign In for Pricing
View Details