Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-22, Human (HEK293-expressed)

Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

Active, measured by its ability to activate STAT following receptor ligand interaction.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

16~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-22 (IL-22) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-22 (IL-22) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ORAI3 Antibody [mFluor Violet 610 SE]
NBP2-98004MFV610 0.1 mL

Rabbit Polyclonal ORAI3 Antibody [mFluor Violet 610 SE]

Ask
View Details
PCYT2 Human shRNA Plasmid Kit (Locus ID 5833)
TL310562 1 Kit

PCYT2 Human shRNA Plasmid Kit (Locus ID 5833)

Ask
View Details
Rabbit Polyclonal MRPS27 Antibody
NBP3-35180-20ul 20 µL

Rabbit Polyclonal MRPS27 Antibody

Ask
View Details
MIR191b Rat MicroRNA Expression Plasmid (MI0015413)
SC403191 10 µg

MIR191b Rat MicroRNA Expression Plasmid (MI0015413)

Ask
View Details
ADAD2 (NM_001145400) Human Tagged ORF Clone
RC226811 10 µg

ADAD2 (NM_001145400) Human Tagged ORF Clone

Ask
View Details