Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-2Rα, His, Human

Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ) . The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells) . IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 µg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

42 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 Calcium Binding Protein (BSA and Azide Free) (AP)
MBS6265949-01 0.1 mL

S100 Calcium Binding Protein (BSA and Azide Free) (AP)

Sign In for Pricing
View Details
S100 Calcium Binding Protein (BSA and Azide Free) (AP)
MBS6265949-02 5x 0.1 mL

S100 Calcium Binding Protein (BSA and Azide Free) (AP)

Sign In for Pricing
View Details
IL-1b Protein (N-His, Mouse)
P512770 100 µg

IL-1b Protein (N-His, Mouse)

Sign In for Pricing
View Details
Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)
orb1649478-01 10 µg

Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)

Sign In for Pricing
View Details
Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)
orb1649478-02 50 µg

Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)

Sign In for Pricing
View Details
Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)
orb1649478-03 500 µg

Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA (C-6His)

Sign In for Pricing
View Details