Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-11, Mouse (HEK293-expressed)

Interleukin-11 (IL-11) is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 contains no cysteine residues or potential glycosylation sites. IL-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 3 ng/ml, measured in a cell proliferation assay using T11 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~21 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin-11 (IL-11) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Interleukin-11 (IL-11) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLM SYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLH LTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyamine Oxidase (PAOX) ELISA Kit
RD-PAOX-Mu-01 96 Tests

Mouse Polyamine Oxidase (PAOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Polyamine Oxidase (PAOX) ELISA Kit
RD-PAOX-Mu-02 48 Tests

Mouse Polyamine Oxidase (PAOX) ELISA Kit

Sign In for Pricing
View Details
Actin (ACTA1) (Muscle Specific) Mouse Monoclonal Antibody [Clone ID: SPM160]
AM33291PU-T 20 µg

Actin (ACTA1) (Muscle Specific) Mouse Monoclonal Antibody [Clone ID: SPM160]

Sign In for Pricing
View Details
Crocein Orange G
TRC-C794955-500MG 500 mg

Crocein Orange G

Sign In for Pricing
View Details
5-HT-1A Antibody
8C12008-AAT 50 µg

5-HT-1A Antibody

Sign In for Pricing
View Details
CKMT2 (NM_001099736) Human Over-expression Lysate
LY420509 100 µg

CKMT2 (NM_001099736) Human Over-expression Lysate

Sign In for Pricing
View Details