Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1RA, Human (HEK293-expressed)

IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.1 μg /ml, measured in a neutralization assay using D10S cells in the presence of 50pg/ml Human IL-1a.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

18-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1G (NM_002707) Human Over-expression Lysate
LY400953 100 µg

PPM1G (NM_002707) Human Over-expression Lysate

Sign In for Pricing
View Details
Sirt3 Mouse Gene Knockout Kit (CRISPR)
KN515803 1 Kit

Sirt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human AGAP8 (AGAP4) activation kit by CRISPRa
GA114681 1 Kit

Human AGAP8 (AGAP4) activation kit by CRISPRa

Sign In for Pricing
View Details
Cystatin A (CSTA/2882), CF740 conjugate, 0.1mg/mL
BNC742882-100 1x 100 µL

Cystatin A (CSTA/2882), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRA1 (RABAC1) (NM_006423) Human Over-expression Lysate
LY401932 100 µg

PRA1 (RABAC1) (NM_006423) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Bromonaphthalene-d7
TRC-B685902-1G 1 g

1-Bromonaphthalene-d7

Sign In for Pricing
View Details