Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-4, His, Human

Insulin-like growth factor-binding protein 4 (IGF-BP-4), also known as IBP-4, is a secreted glycoprotein belonging to the IGFBP family. IGF-BP-4 is produced by osteoblasts, epidermis, ovarian follicles and other tissues. It binds both insulin-like growth factor (IGF) I and II, and it circulates in the plasma in both glycosylated and non-glycosylated forms. IGF-BP-4 prolongs the half-life of the IGFs and has been shown to inhibit or stimulate the growth-promoting effects of the IGFs. Pregnancy Associated Plasma Protein A (PAPP-A) proteolytically cleaves IGF-BP-4 and reduces its affinity to bind IGFs, and thus serves as an important regulator of IGF-BP-4 function.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a bioassay using FDC-P1 cells in the presence of 15ng/ml human IGF-II.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

30-35 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-4, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCM ELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRA LERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (chloromethyl) bicyclo[2.2.2]oct-1-yl 4-nitrobenzene-1-sulphonate
OR26293 1 Each

2- (chloromethyl) bicyclo[2.2.2]oct-1-yl 4-nitrobenzene-1-sulphonate

Sign In for Pricing
View Details
Rabbit Monoclonal ACOX1 Antibody (102) [Alexa Fluor 594]
NBP2-89866AF594 0.1 mL

Rabbit Monoclonal ACOX1 Antibody (102) [Alexa Fluor 594]

Sign In for Pricing
View Details
Methyltetrazine-PEG4-SS-PEG4-methyltetrazine
T18352-01 100 mg

Methyltetrazine-PEG4-SS-PEG4-methyltetrazine

Sign In for Pricing
View Details
Methyltetrazine-PEG4-SS-PEG4-methyltetrazine
T18352-02 500 mg

Methyltetrazine-PEG4-SS-PEG4-methyltetrazine

Sign In for Pricing
View Details
FAM93B AAV siRNA Pooled Vector
20216161 1.0 µg

FAM93B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LOX
322531-01 50 µL

LOX

Sign In for Pricing
View Details