Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-2, His, Human

IGF-BP-2, also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a bioassay using FDC-P1 cells in the presence of 15 ng/ml human IGF-II.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

6-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-2, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-2, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ectonucleoside triphosphate diphosphohydrolase 4,ENTPD4 ELISA KIT
JOT-EK5223Hu-01 48 Well

Human Ectonucleoside triphosphate diphosphohydrolase 4,ENTPD4 ELISA KIT

Sign In for Pricing
View Details
Human Ectonucleoside triphosphate diphosphohydrolase 4,ENTPD4 ELISA KIT
JOT-EK5223Hu-02 96 Well

Human Ectonucleoside triphosphate diphosphohydrolase 4,ENTPD4 ELISA KIT

Sign In for Pricing
View Details
Recombinant Nerve Growth Factor (NGF)
TRV-0007127-01 10 µg

Recombinant Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
Recombinant Nerve Growth Factor (NGF)
TRV-0007127-02 50 µg

Recombinant Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
Recombinant Nerve Growth Factor (NGF)
TRV-0007127-03 100 µg

Recombinant Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
Recombinant Nerve Growth Factor (NGF)
TRV-0007127-04 200 µg

Recombinant Nerve Growth Factor (NGF)

Sign In for Pricing
View Details