Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-β, Human

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Nicotiana tomentosiformis ATP synthase subunit b, chloroplastic (atpF), partial
MBS7078496 Inquire

Recombinant Nicotiana tomentosiformis ATP synthase subunit b, chloroplastic (atpF), partial

Ask
View Details
Hamster Heme Oxygenase 1, Decycling ELISA Kit
MBS034959-01 48 Well

Hamster Heme Oxygenase 1, Decycling ELISA Kit

Ask
View Details
Hamster Heme Oxygenase 1, Decycling ELISA Kit
MBS034959-02 96 Well

Hamster Heme Oxygenase 1, Decycling ELISA Kit

Ask
View Details
Hamster Heme Oxygenase 1, Decycling ELISA Kit
MBS034959-03 5x 96 Well

Hamster Heme Oxygenase 1, Decycling ELISA Kit

Ask
View Details
Hamster Heme Oxygenase 1, Decycling ELISA Kit
MBS034959-04 10x 96 Well

Hamster Heme Oxygenase 1, Decycling ELISA Kit

Ask
View Details
Rabbit Far Upstream Element-Binding Protein 1 (FUBP1) ELISA Kit
MBS9908083 Inquire

Rabbit Far Upstream Element-Binding Protein 1 (FUBP1) ELISA Kit

Ask
View Details