What is the catalog number for RecombinantIFN-β, Human?

The catalog number for RecombinantIFN-β, Human is BK0307.

What sizes are available for RecombinantIFN-β, Human?

RecombinantIFN-β, Human is available in the following size(s): 5 μg, 25 µg.

How many pack sizes does RecombinantIFN-β, Human come in?

RecombinantIFN-β, Human is available in 2 different pack sizes.

Is RecombinantIFN-β, Human in stock?

RecombinantIFN-β, Human is currently made to order / not held in immediate stock. Contact us for lead time.

RecombinantIFN-β, Human

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN