Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-β, Human

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Plcb2 Mouse shRNA Lentiviral Particle (Locus ID 18796)
TL516527V 500 µL Each

Plcb2 Mouse shRNA Lentiviral Particle (Locus ID 18796)

Ask
View Details
Peroxin 11β Antibody
C17630-01 50 μL

Peroxin 11β Antibody

Ask
View Details
Peroxin 11β Antibody
C17630-02 100 µL

Peroxin 11β Antibody

Ask
View Details
Tolcide 2230 (90%)
TRC-T535280-250MG 250 mg

Tolcide 2230 (90%)

Ask
View Details
Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT
YLA0057RA-01 48 Tests

Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Ask
View Details
Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT
YLA0057RA-02 96 Tests

Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Ask
View Details