Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-β, Human

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WOAF-2 AB Labels
035102 Pack of 350 Label(s)

WOAF-2 AB Labels

Sign In for Pricing
View Details
KCTD13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1127707 1.0 µg DNA

KCTD13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse STE20-like serine/threonine-protein kinase (SLK) ELISA Kit
EK7235 48 Tests

Mouse STE20-like serine/threonine-protein kinase (SLK) ELISA Kit

Sign In for Pricing
View Details
Pacific Blue™ anti-mouse CD105
GT02735 25 µg

Pacific Blue™ anti-mouse CD105

Sign In for Pricing
View Details
MAGEA5 Rabbit Polyclonal Antibody (RBITC)
orb1041077 100 µL

MAGEA5 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Duck Presenilin 1 ELISA Kit
MBS070211 Inquire

Duck Presenilin 1 ELISA Kit

Sign In for Pricing
View Details