RecombinantGRO-α/KC/CINC-1/CXCL1, Rat
GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Active, measured in a functional assay using HUVEC cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
~7.8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Rabbit anti-Escherichia coli (strain 55989/EAEC) RLME Polyclonal Antibody
Phospho-NEUROD1 (Ser274) Rabbit Polyclonal Antibody (Cy5.5)
![Mouse Monoclonal RAB21 Antibody (OTI6E12) [Dylight 594]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Mouse Monoclonal RAB21 Antibody (OTI6E12) [Dylight 594]