Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Rat (HEK293-expressed)

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Glutathione S-Transferase pi 1/GSTP1 Antibody (003) [Janelia Fluor 646]
NBP2-89323JF646 0.1 mL

Rabbit Monoclonal Glutathione S-Transferase pi 1/GSTP1 Antibody (003) [Janelia Fluor 646]

Sign In for Pricing
View Details
Elab Bright™ Violet 510 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103R1 50 Tests

Elab Bright™ Violet 510 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Lentiviral human TSPAN2 shRNA (UAS) - Lentiviral human TSPAN2 shRNA (UAS, GFP) (100)
GTR15332136 1 Vial

Lentiviral human TSPAN2 shRNA (UAS) - Lentiviral human TSPAN2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit
MBS2604596-01 48 Well

Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details
Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit
MBS2604596-02 96 Well

Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details
Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit
MBS2604596-03 5x 96 Well

Rabbit 14-3-3 protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details