Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFasR, Human

Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 <0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

17~29 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-02 0.1 mg (E-Coli)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-03 0.02 mg (Yeast)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-04 0.1 mg (Yeast)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-05 0.02 mg (Baculovirus)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Arginine repressor (argR)
MBS1293180-06 0.02 mg (Mammalian-Cell)

Recombinant Vibrio fischeri Arginine repressor (argR)

Sign In for Pricing
View Details