Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCNTF, Human (HEK293-expressed)

Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: dorsal root ganglion sensory neurons, sympathetic ganglion neurons, embryonic motor neurons, major pelvic ganglion neurons and hippocampal neurons. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The gene for human CNTF has been localized to the proximal region of the long arm of chromosome 11. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL-6, IL-11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.20 μg/ml, measured in a cell proliferation assay using TF-1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

22~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Ciliary Neurotrophic Factor (CNTF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Ciliary Neurotrophic Factor (CNTF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAY RTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLK VLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Chloropyrazino[2,3-d]pyridazin-5 (6H) -one
OR1037360-01 100 mg

8-Chloropyrazino[2,3-d]pyridazin-5 (6H) -one

Sign In for Pricing
View Details
8-Chloropyrazino[2,3-d]pyridazin-5 (6H) -one
OR1037360-02 250 mg

8-Chloropyrazino[2,3-d]pyridazin-5 (6H) -one

Sign In for Pricing
View Details
Ethyl 5-bromo-2- (chloromethyl) nicotinate
OR1071629-01 50 mg

Ethyl 5-bromo-2- (chloromethyl) nicotinate

Sign In for Pricing
View Details
Ethyl 5-bromo-2- (chloromethyl) nicotinate
OR1071629-02 100 mg

Ethyl 5-bromo-2- (chloromethyl) nicotinate

Sign In for Pricing
View Details
Ethyl 5-bromo-2- (chloromethyl) nicotinate
OR1071629-03 250 mg

Ethyl 5-bromo-2- (chloromethyl) nicotinate

Sign In for Pricing
View Details
Ethyl 5-bromo-2- (chloromethyl) nicotinate
OR1071629-04 1 g

Ethyl 5-bromo-2- (chloromethyl) nicotinate

Sign In for Pricing
View Details