Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantBetacellulin, Mouse (HEK293-expressed)

Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 <0.08ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

19-24 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal DFF40/CAD Antibody (36A349) [FITC]
NB120-13592F 0.1 mL

Mouse Monoclonal DFF40/CAD Antibody (36A349) [FITC]

Ask
View Details
Prkag2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37628114 3x 1.0 µg

Prkag2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
Compound Fr13051
MF-0007516-01 100 mg

Compound Fr13051

Ask
View Details
Compound Fr13051
MF-0007516-02 2 mg

Compound Fr13051

Ask
View Details
Compound Fr13051
MF-0007516-03 10 mg

Compound Fr13051

Ask
View Details