RecombinantBetacellulin, Mouse (HEK293-expressed)
Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 <0.08ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
19-24 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items