RecombinantBetacellulin, Human
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 4 pg/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
15~18 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Phospho-c-Met (Tyr1234/1235) Rabbit pAb, 1 pack = 50 µL
Recombinant Mouse SPATA4 Protein, His (Fc)-Avi-tagged
Anti-B. anthracis Protective Antigen Monoclonal antibody, Clone CAP0103