Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAmphiregulin, Human

Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Otud7b (NM_001107697) Rat Tagged ORF Clone Lentiviral Particle
RR201429L4V 200 µL

Otud7b (NM_001107697) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-SLC39A6 Rabbit Monoclonal Antibody
MA5146-.1 100 µL

Anti-SLC39A6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SCAI Antibody Picoband® Fluoro647 Conjugated
A04877-1-Fluoro647 100 µg/Vial

Anti-SCAI Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
ADAP2 siRNA (Mouse)
orb1837195-01 15 nmol

ADAP2 siRNA (Mouse)

Sign In for Pricing
View Details
ADAP2 siRNA (Mouse)
orb1837195-02 30 nmol

ADAP2 siRNA (Mouse)

Sign In for Pricing
View Details
GRTP1 siRNA (Human)
MBS8232422-01 15 nmol

GRTP1 siRNA (Human)

Sign In for Pricing
View Details