Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAmphiregulin, Human

Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (Phospho-Tyr1068) Rabbit mAb
MBS9468090-01 0.05 mL

EGFR (Phospho-Tyr1068) Rabbit mAb

Sign In for Pricing
View Details
EGFR (Phospho-Tyr1068) Rabbit mAb
MBS9468090-02 0.1 mL

EGFR (Phospho-Tyr1068) Rabbit mAb

Sign In for Pricing
View Details
EGFR (Phospho-Tyr1068) Rabbit mAb
MBS9468090-03 5x 0.1 mL

EGFR (Phospho-Tyr1068) Rabbit mAb

Sign In for Pricing
View Details
FSHR Conjugated Antibody
orb1622279 100 µL

FSHR Conjugated Antibody

Sign In for Pricing
View Details
AHDC1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0061102 1.0 µg DNA

AHDC1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SPIRE1 Protein Vector (Human) (pPM-C-HA)
PV039923 500 ng

SPIRE1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details