Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAmphiregulin, Human

Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 Peptide - middle region
MBS3244572-01 0.1 mg

DMC1 Peptide - middle region

Sign In for Pricing
View Details
DMC1 Peptide - middle region
MBS3244572-02 5x 0.1 mg

DMC1 Peptide - middle region

Sign In for Pricing
View Details
CLPTM1L Human Gene Knockout Kit (CRISPR)
KN406866 1 Kit

CLPTM1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RGD1562747 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6433208 1.0 µg DNA

RGD1562747 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Bovine Neurotrophin 3 (NTF3) ELISA Kit-Sandwich
EK10F163-01 48 Test

Bovine Neurotrophin 3 (NTF3) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Neurotrophin 3 (NTF3) ELISA Kit-Sandwich
EK10F163-02 96 Tests

Bovine Neurotrophin 3 (NTF3) ELISA Kit-Sandwich

Sign In for Pricing
View Details