Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAmphiregulin, Human

Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Protein BTG1 (BTG1) Human ELISA Kit
G2482 96 Tests

Protein BTG1 (BTG1) Human ELISA Kit

Ask
View Details
GENLISA™ Mouse Grin1 (Grin1) ELISA
KLM1275 1x 96 Well

GENLISA™ Mouse Grin1 (Grin1) ELISA

Ask
View Details
GENLISA™ Human WNT1 Inducible Signaling Pathway Protein 2 (WISP2) ELISA
KBH2360 1x 96 Well

GENLISA™ Human WNT1 Inducible Signaling Pathway Protein 2 (WISP2) ELISA

Ask
View Details
Mouse Cfap69 qPCR Primer Pair
QM53606S 200 Tests

Mouse Cfap69 qPCR Primer Pair

Ask
View Details
Propyl butyrate
JH919797 1 Each

Propyl butyrate

Ask
View Details