Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAdiponectin/Acrp30, Human

Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

16~17 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pBluescriptR-SMAP1 Plasmid
PVT21293 2 µg

pBluescriptR-SMAP1 Plasmid

Ask
View Details
VGCNL1 (NALCN) (NM_052867) Human Tagged ORF Clone Lentiviral Particle
RC217074L1V 200 µL

VGCNL1 (NALCN) (NM_052867) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 650)
247367-ML650 100 µL

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 650)

Ask
View Details
Recombinant Human Mammaglobin-A Protein, GST, E.coli-50ug
QP7590-ec-50ug 50ug

Recombinant Human Mammaglobin-A Protein, GST, E.coli-50ug

Ask
View Details
Matrix Metalloproteinase 9/Gelatinase B (MMP9) Mouse anti-Human Monoclonal (F11P2C3) Antibody
GWB-482A2C 0.05 mg

Matrix Metalloproteinase 9/Gelatinase B (MMP9) Mouse anti-Human Monoclonal (F11P2C3) Antibody

Ask
View Details