Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantAdiponectin/Acrp30, Human

Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

16~17 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CXCL8/IL-8 Reference Antibody (ABX-IL8)
MBS9247505-01 0.1 mg

Anti-CXCL8/IL-8 Reference Antibody (ABX-IL8)

Sign In for Pricing
View Details
Anti-CXCL8/IL-8 Reference Antibody (ABX-IL8)
MBS9247505-02 5x 0.1 mg

Anti-CXCL8/IL-8 Reference Antibody (ABX-IL8)

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin 5 / PRDX5 Protein (His tag)
MBS2545836-01 0.1 mg

Recombinant Human Peroxiredoxin 5 / PRDX5 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin 5 / PRDX5 Protein (His tag)
MBS2545836-02 5x 0.1 mg

Recombinant Human Peroxiredoxin 5 / PRDX5 Protein (His tag)

Sign In for Pricing
View Details
Cubilin Antibody / CUBN
RQ4756 100 µL

Cubilin Antibody / CUBN

Sign In for Pricing
View Details
WNT4 Polyclonal Antibody, HRP Conjugated
A61801-050 50 µL

WNT4 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details