Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF165, Rat (CHO-expressed)

Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 4 ng/ml, measured in a cell proliferation assay using HUVEC cells, corresponding to a specific activity of >2.5 x 10ˆ5 units/mg

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

35-48 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD KPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orphanin FQ, (Nociceptin)
E-PP-1655-01 1 mg

Orphanin FQ, (Nociceptin)

Sign In for Pricing
View Details
Orphanin FQ, (Nociceptin)
E-PP-1655-02 10 mg

Orphanin FQ, (Nociceptin)

Sign In for Pricing
View Details
Orphanin FQ, (Nociceptin)
E-PP-1655-03 5 mg

Orphanin FQ, (Nociceptin)

Sign In for Pricing
View Details
Anti-Nestin(Chicken)
G161 100 µL

Anti-Nestin(Chicken)

Sign In for Pricing
View Details
C9orf135 ORF Vector (Human) (pORF)
14779011 1.0 µg DNA

C9orf135 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Nitronium tetrafluoroborate 96%
N10210-01 5 g

Nitronium tetrafluoroborate 96%

Sign In for Pricing
View Details